missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Spike Antibody [mFluor Violet 500 SE], Novus Biologicals Biologicals™
Shop alle Bio Techne produkterBeskrivelse
Spike Polyclonal antibody specifically detects Spike in SARS-CoV samples. It is validated for ELISA,Western Blot
Tekniske data
Tekniske data
| Antigen | Spike |
| Applikationer | ELISA, Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | mFluor Violet 500 SE |
| Formulering | 50mM Sodium Borate |
| Værtsarter | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of coronavirus Spike S1 (NP_828851.1).,, Sequence:, MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRG |
| Oprensningsmetode | Affinity purified |
| Mængde | 0.1 mL |
| Regulatorisk status | RUO |
| Vis mere |
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?