missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Beskrivelse
SPC25 Polyclonal antibody specifically detects SPC25 in Human samples. It is validated for ELISA,Western Blot
Tekniske data
Tekniske data
| Antigen | SPC25 |
| Applikationer | ELISA, Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | Alexa Fluor 405 |
| Formulering | 50mM Sodium Borate |
| Gene Alias | AD024, hSpc25, kinetochore protein Spc25, MGC22228,2600017H08Rik, SPBC25, SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae), spindle pole body component 25 homolog, spindle pole body component 25 homolog (S. cerevisiae) |
| Værtsarter | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-224 of human SPC25 (NP_065726.1).,, Sequence:, ANKANAERLKRLQKSADLYKDRLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVYN |
| Oprensningsmetode | Affinity purified |
| Mængde | 0.1 mL |
| Vis mere |
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?