missing translation for 'onlineSavingsMsg'
Learn More

Smad4 Rabbit anti-Human, Mouse, Rat, Clone: 1H7D3, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-15673-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18310546

  • 3692.13 DKK / 100µL
Estimated Shipment: 25-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Smad4 Monoclonal antibody specifically detects Smad4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), ChIP assay (ChIP), KnockDown
Specifications

Specifications

Smad4
Monoclonal
Unconjugated
PBS, 0.05% BSA, 50% glycerol, pH7.3
Rabbit
Affinity purified
RUO
Primary
Human, Mouse, Rat
Purified
ChIP Assay, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation, KnockDown
1H7D3
Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:500 - 1:1000, Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation (ChIP) 1:500 - 1:1000, Knockout Validated
DPC4SMAD, mothers against DPP homolog 4 (Drosophila), hSMAD4, JIP, MAD homolog 4, MADH4mothers against decapentaplegic homolog 4, mothers against decapentaplegic homolog 4, mothers against decapentaplegic, Drosophila, homolog of, 4, SMAD 4, SMAD family member 4MAD, mothers against decapentaplegic homolog 4 (Drosophila), SMAD, mothers against DPP homolog 4, Smad4
Recombinant fusion protein containing a sequence corresponding to amino acids 320-552 of human Smad4 (NP_005350.1). PEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD
100 μg
Signal Transduction, Stem Cell Signaling Pathway
4089
Store at -20°C. Avoid freeze-thaw cycles.
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers