Learn More
Abnova™ SLC25A3 Recombinant Protein
Recombinant protein for SLC25A3 (human) gene
Brand: Abnova™ H00005250-P01.10ug
Description
The encoded protein catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. It contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family.
- Human SLC25A3 full-length ORF ( AAH00998, 1 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal
- Description: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3
- Theoretical molecular weight: 65.45kDa
- Preparation method: in vitro wheat germ expression system
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer
Sequence: MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPME AAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACCERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ
Best use within three months from the date of receipt.
ELISA, western blotting (recombinant protein), antibody production, protein array
Specifications
AAH00998 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
65.4 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 μg | |
MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACCERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ | |
OK/SW-cl.48/PHC | |
SLC25A3 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
5250 | |
SLC25A3 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
SLC25A3 | |
Human | |
Recombinant | |
Solution |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.