missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. SC65 Antibody - Azide and BSA Free, R&D Systems™

SC65 Antibody - Azide and BSA Free, R&D Systems™

Artikelnummer. 18611711 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.02 mL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18611711 0.1 mL
18678260 0.02 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18611711 Leverandør Novus Biologicals Leverandørnr. NBP2946400.1ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Se alternative produkter

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SC65 Polyclonal antibody specifically detects SC65 in Human, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen SC65
Applikationer Western Blot
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Western Blot 1:500-1:2000
Formulering PBS (pH 7.3), 50% glycerol
Gene Alias leprecan-like 4, Leprecan-like protein 4, NO55, 55kDa, NOL55, Nucleolar autoantigen No55, SC65rat synaptonemal complex protein, synaptonemal complex protein SC65
Værtsarter Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 338-437 of human P3H4 (NP_006446.1). FHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFTHMYLQSDDEMELEETEPPLEPEDALSDAEFEGEGDYEEGMYADWWQEPDAKGDEAEAEPEPELA
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Cell Cycle and Replication
Primær eller sekundær Primary
Gen-id (Entrez) 10609
Målarter Human, Rat
Indhold og opbevaring Store at -20°C. Avoid freeze-thaw cycles.
Produkttype Antibody
Form Purified
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.