missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. RhoB Antibody - Azide and BSA Free, R&D Systems™

RhoB Antibody - Azide and BSA Free, R&D Systems™

Artikelnummer. 18621222 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.02 mL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18621222 0.02 mL
18649551 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18621222 Leverandør Novus Biologicals Leverandørnr. NBP2941040.02ml
 Begrænset vare
Forventet forsendelse: 02-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

RhoB Polyclonal specifically detects RhoB in Human, Mouse, Rat samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen RhoB
Applikationer Western Blot
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Western Blot 1:500 - 1:1000
Formulering PBS (pH 7.3), 50% glycerol
Gene Alias ARH6MSTP081, ARHBAplysia RAS-related homolog 6, h6, MST081, oncogene RHO H6, ras homolog gene family, member B, Rho cDNA clone 6, RHOH6RhoB, rho-related GTP-binding protein RhoB
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-190 of human RhoB (NP_004031.1). VPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCI
Oprensningsmetode Affinity purified
Mængde 0.02 mL
Regulatorisk status RUO
Forskningsdisciplin Angiogenesis
Primær eller sekundær Primary
Gen-id (Entrez) 388
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at -20°C. Avoid freeze-thaw cycles.
Produkttype Antibody
Form Purified
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.