missing translation for 'onlineSavingsMsg'
Learn More

RELL2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10023-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18310377

  • 3427.56 DKK / 100µL
Estimated Shipment: 25-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

RELL2 Polyclonal specifically detects RELL2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

RELL2
Polyclonal
Western Blot 1.0 ug/ml
C5orf16, chromosome 5 open reading frame 16, FLJ90583, receptor expressed in lymphoid tissues like 2, RELT-like 2, RELT-like protein 2
The immunogen is a synthetic peptide directed towards the middle region of human RELL2 (NP_001123501.1). Peptide sequence RYGLHEHRDGSPTDRSWGSGGGQDPGGGQGSGGGQPKAGMPAMERLPPER
100 μg
Primary
Human
Purified
Western Blot
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
285613
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers