missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RELL2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10023-100UL
Additional Details : Weight : 0.00970kg
Description
RELL2 Polyclonal specifically detects RELL2 in Human samples. It is validated for Western Blot.Specifications
| RELL2 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| C5orf16, chromosome 5 open reading frame 16, FLJ90583, receptor expressed in lymphoid tissues like 2, RELT-like 2, RELT-like protein 2 | |
| The immunogen is a synthetic peptide directed towards the middle region of human RELL2 (NP_001123501.1). Peptide sequence RYGLHEHRDGSPTDRSWGSGGGQDPGGGQGSGGGQPKAGMPAMERLPPER | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 285613 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |