missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Artikelnummer. p-7120949 Shop alle Bio Techne produkter
Klik for at se tilgængelige muligheder
Mængde:
100 μg
200 μg
500 μg
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 18735843

Brand: Novus Biologicals™ NBP254789100UG

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

4020.50 DKK valid until 2025-12-16
BEDSTE tilbudspris! Brug kampagnekoden "24090" for at få din tilbudspris.
Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Highly purified and high bioactivity. Generating reliable and reproducible results.

An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.
TRUSTED_SUSTAINABILITY

Tekniske data

Til brug med (applikation) In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot
Formulering PBS
Gen-id (Entrez) 6622
Navn Human alpha-Synuclein Aggregate Protein
Oprensningsmetode >95% pure by SDS-PAGE
Mængde 100 μg
Kilde E.Coli
Immunogen MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Opbevaringskrav Store at −80°C. Avoid freeze-thaw cycles.
Regulatorisk status RUO
Gene Alias alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Gen symbol SNCA
Biologisk aktivitet Endogenous alpha-synuclein phosphorylation. 100μM alpha synuclein protein monomer seeded with 10nM alpha synuclein protein aggregate in 25μM Thioflavin T (PBS pH 7.4, 100μL reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 24 hours. Fluorescence was measured by excitation at 450nm and emission at 485nm on a Molecular Devices Gemini XPS microplate reader.
Produkttype Recombinant Protein
Konjugeret Unconjugated
Krydsreaktivitet Human
Rekombinant Recombinant
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.