missing translation for 'onlineSavingsMsg'
Learn More

RCOR1/CoREST Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10324-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18310604

  • 3439.44 DKK / 100µL
Estimated Shipment: 25-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

RCOR1/CoREST Polyclonal specifically detects RCOR1/CoREST in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

RCOR1/CoREST
Polyclonal
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
KIAA0071CORESTRCORREST corepressor, Protein CoREST, REST corepressor 1
The immunogen is a synthetic peptide directed towards the middle region of human RCOR1/CoREST (NP_055971). Peptide sequence DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS
100 μg
Transcription Factors and Regulators
23186
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers