missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RCOR1/CoREST Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10324-100UL
Additional Details : Weight : 0.00970kg
Description
RCOR1/CoREST Polyclonal specifically detects RCOR1/CoREST in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
RCOR1/CoREST | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
KIAA0071CORESTRCORREST corepressor, Protein CoREST, REST corepressor 1 | |
The immunogen is a synthetic peptide directed towards the middle region of human RCOR1/CoREST (NP_055971). Peptide sequence DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS | |
100 μg | |
Transcription Factors and Regulators | |
23186 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |