missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ RCN1 Recombinant Protein

Name: Abnova&trade; RCN1 Recombinant Protein
Brand: Abnova&trade;
SKU: 16150142
Price: 4040.00 EUR

Marca: Abnova™ H00005954-P01.25ug

Dettagli aggiuntivi : Weight : 0.00010kg

Codice prodotto. 16150142

Estimated Shipment: 25-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Descrizione

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Accession Number	AAH10120
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	58.63
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Immunogen	PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL
Gene Alias	FLJ37041/PIG20/RCAL/RCN
Gene Symbol	RCN1
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	5954
Name	RCN1 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	RCN1
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Suggerimenti di prodotto

Descrizione