missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ RBX1 Recombinant Protein
2735.00 DKK - 4145.00 DKK
Specifications
Accession Number | AAH01466 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Gene ID (Entrez) | 9978 |
Molecular Weight (g/mol) | 37.62 |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16124322
|
Abnova™
H00009978-P01.10ug |
10 ÎĽg |
2735.00 DKK
10µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
16134322
|
Abnova™
H00009978-P01.25ug |
25 ÎĽg |
4145.00 DKK
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH01466 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
37.62 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
RBX1 | |
Human | |
Recombinant | |
Solution |
Antibody Production, Protein Array, ELISA, Western Blot | |
9978 | |
RBX1 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH | |
BA554C12.1/MGC13357/MGC1481/RNF75/ROC1 | |
RBX1 | |
Wheat Germ (in vitro) | |
GST |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ RBX1 Recombinant Protein