Få mere at vide
Abnova™ RAC1 Recombinant Protein
Beskrivelse
The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene.
- Theoretical MW (kDa): 46.86
- Preparation Method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLIPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Tekniske data
Tekniske data
| Adgangsnummer | AAH04247 |
| Til brug med (applikation) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulering | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Gen-id (Entrez) | 5879 |
| Molekylvægt (g/mol) | 46.86 |
| Navn | RAC1 (Human) Recombinant Protein (P01) |
| pH-område | 8 |
| Fremstillingsmetode | In vitro wheat germ expression system |
| Oprensningsmetode | Glutathione Sepharose 4 Fast Flow |
| Kvalitetskontrol test | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Vis mere |
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.