missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ RAB33A Recombinant Protein

Name: Abnova&trade; RAB33A Recombinant Protein
Brand: Abnova&trade;
SKU: 16133572
Price: 4150.00 EUR

Brand: Abnova™ H00009363-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16133572

Estimated Shipment: 10-05-2023
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH09996
Format	Solution
Gene ID (Entrez)	9363
Name	RAB33A (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	RAB33A
Cross Reactivity	Human
Recombinant	Yes

For Use With (Application)	Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight	51.81
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Immunogen	MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC
Gene Alias	MGC1488/RabS10
Gene Symbol	RAB33A
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Description