Learn More
Abnova™ PYY (Human) Recombinant Protein (P01)
Human PYY full-length ORF with GST-tag at N-terminal
Brand: Abnova™ H00005697-P01.25ug
Additional Details : Weight : 0.00010kg
Description
- Theoretical MW: 37.5kDa
- Preparation Method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Best use within three months from the date of receipt of this protein
Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array
Specifications
AAH41057.1 | |
Solution | |
5697 | |
PYY (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
PYY | |
Human | |
Yes |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
37.5 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW | |
PYY1 | |
PYY | |
Wheat Germ (in vitro) | |
GST |