missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PTPRS Recombinant Protein

Brand:  Abnova™ H00005802-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139921

  • 2665.00 DKK / 10µg
Estimated Shipment: 22-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH29496
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
36.52
8
Glutathione Sepharose 4 Fast Flow
10 ug
EPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLRGP
PTPSIGMA
PTPRS
Wheat Germ (in vitro)
GST
Antibody Production, Protein Array, ELISA, Western Blot
5802
PTPRS (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PTPRS
Human
Recombinant
Solution
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers