missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Beskrivelse
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTPN20 The PTPN20 Recombinant Protein Antigen is derived from E. coli. The PTPN20 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Tekniske data
Tekniske data
| Protein længde | MALELKNLPGEFNSGNQPSNREKNRYRDILP |
| Renhed | >80% by SDS-PAGE and Coomassie blue staining |
| Fælles navn | PTPN20 |
| Indhold og opbevaring | Store at −20°C short term. Avoid freeze-thaw cycles. |
| Formulering | PBS and 1M Urea, pH 7.4 |
| Til brug med (applikation) | AC |
| Gene Alias | protein tyrosine phosphatase, non-receptor type 20, bA42B19.1, protein tyrosine phosphatase, non-receptor type 20B |
| Gen symbol | PTPN20 |
| Etikettype | Unlabeled |
| Molekylvægt (g/mol) | 21 kDa |
| Vis mere |
For Research Use Only.
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?