missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30499047

Protein Phosphatase 1 beta Antibody [Alexa Fluor« 700], Novus Biologicals Biologicals™

Artikelnummer. 30499047 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30499047 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30499047 Leverandør Novus Biologicals Leverandørnr. NBP335355AF700

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

Protein Phosphatase 1 beta Polyclonal antibody specifically detects Protein Phosphatase 1 beta in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen Protein Phosphatase 1 beta
Applikationer ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Klassifikation Polyclonal
Konjugeret Alexa Fluor 700
Formulering 50mM Sodium Borate
Gene Alias EC 3.1.3.16, EC 3.1.3.53, MGC3672, PP1beta, PP-1Bprotein phosphatase 1, catalytic subunit, delta isoform, PPP1CD, protein phosphatase 1, catalytic subunit, beta isoform, protein phosphatase 1, catalytic subunit, beta isozyme, protein phosphatase 1-beta, protein phosphatase 1-delta, serine/threonine protein phosphatase PP1-beta catalytic subunit, serine/threonine-protein phosphatase PP1-beta catalytic subunit
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 227-327 of human Protein Phosphatase 1 beta (NP_002700.1).,, Sequence:, VEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Cancer, Lipid and Metabolism, Protein Phosphatase
Primær eller sekundær Primary
Gen-id (Entrez) 5500
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.