missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pref-1/DLK1/FA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-32358-25ul
This item is not returnable.
View return policy
Description
Pref-1/DLK1/FA1 Polyclonal specifically detects Pref-1/DLK1/FA1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Pref-1/DLK1/FA1 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| delta-like 1 homolog (Drosophila), DLK, DLK-1, FA1fetal antigen 1, pG2delta-like homolog (Drosophila), preadipocyte factor 1, Pref-1, PREF1, protein delta homolog 1, secredeltin, ZOG | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DLK1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ | |
| 25 μL | |
| Signal Transduction | |
| 8788 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Pref-1/DLK1/FA1 Antibody, Novus Biologicals™ > 25 μL, Unlabeled
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction