missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. PPAPDC3 Antibody, R&D Systems™

PPAPDC3 Antibody, R&D Systems™

Artikelnummer. 18612029 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18612029 25 μL
18272732 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18612029 Leverandør Novus Biologicals Leverandørnr. NBP25602825ul
 Begrænset vare
Forventet forsendelse: 02-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PPAPDC3 Polyclonal specifically detects PPAPDC3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin).
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen PPAPDC3
Applikationer Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulering PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias C9orf67, chromosome 9 open reading frame 67, EC 3.1.3, EC 3.1.3.-, FLJ14662, KIAA0515, MGC12921, NET39, phosphatidic acid phosphatase type 2 domain containing 3, Phosphatidic acid phosphatase type 2 domain-containing protein 3, probable lipid phosphate phosphatase PPAPDC3
Gensymboler PLPP7
Værtsarter Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GPYETSPSLLDYLTMDIYAFPAGHASRAAMVSK
Oprensningsmetode Affinity Purified
Mængde 25 μL
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 84814
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Indhold og opbevaring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Produkttype Antibody
Isotype IgG
Produktlinje Novus
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.