missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ POLR2D (Human) Recombinant Protein
Human POLR2D full-length ORF ( AAH17205, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
2665.00 DKK - 4040.00 DKK
Specifications
| Accession Number | AAH17205 |
|---|---|
| Gene ID (Entrez) | 5433 |
| Name | polymerase (RNA) II (DNA directed) polypeptide D |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16179301
|
Abnova™
H00005433-P01.10UG |
10 μg |
2665.00 DKK
10µg |
Estimated Shipment: 24-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16189301
|
Abnova™
H00005433-P01.25UG |
25 μg |
4040.00 DKK
25µg |
Estimated Shipment: 24-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
- Sequence: MAAGGSDPRAGDVEEDASQLIFPKGFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
Specifications
| AAH17205 | |
| polymerase (RNA) II (DNA directed) polypeptide D | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| HSRBP4, HSRPB4, RBP4 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 5433 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| POLR2D | |
| GST |