missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Novus Biologicals™ Phenylalanine Hydroxylase Recombinant Protein Antigen
Shop alle Bio Techne produkterBeskrivelse
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAH. Source: E.coli Amino Acid Sequence: MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPG The Phenylalanine Hydroxylase Recombinant Protein Antigen is derived from E. coli. The Phenylalanine Hydroxylase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-80917. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Tekniske data
Tekniske data
| Gen-id (Entrez) | 5053 |
| Arter | Human |
| Oprensningsmetode | Chromatography |
| Renhed | >80% |
| Koncentration | 0.5mg/mL |
| Indhold og opbevaring | Store at -20°C. Avoid freeze-thaw cycles. |
| Formulering | PBS and 1M Urea, pH 7.4. |
| Til brug med (applikation) | Blocking/Neutralizing, Control |
| Gen symbol | PAH |
| Etikettype | Unlabeled |
| Vis mere |
For Research Use Only
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?