missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ PHD4/HIF Prolyl Hydroxylase 4 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Marke:  Novus Biologicals™ NBP1-83989PEP

Weitere Details : Weight : 0.00970kg

Artikelnummer. 18310450

  • 1842.28 DKK / 0.10mL
Estimated Shipment: 25-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Beschreibung

Beschreibung

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human P4HTM. The PHD4/HIF Prolyl Hydroxylase 4 Recombinant Protein Antigen is derived from E. coli. The PHD4/HIF Prolyl Hydroxylase 4 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-83989. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Spezifikation

Spezifikation

54681
Chromatography
0.5mg/mL
PBS and 1M Urea, pH 7.4.
P4HTM
34kDa
0.1mL
E.Coli
KADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGLPSILRPGTP
Human
>80%
Store at -20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
Unlabeled
PHD4/HIF Prolyl Hydroxylase 4
RUO
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83989. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Produktvorschläge

Produktvorschläge

Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote

For Research Use Only