missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Biokemiske reagenser
  4. Peptider
  5. 18209282

Novus Biologicals™ PGLYRP2/PGRP-L Recombinant Protein Antigen

Artikelnummer. 18209282 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μl
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18209282 100 μl
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18209282 Leverandør Novus Biologicals™ Leverandørnr. NBP257939PEP

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PGLYRP2/PGRP-L. Source: E.coli Amino Acid Sequence: DTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHFTATVKPRPARSVSKRSRREPPPRTLPATDL The PGLYRP2/PGRP-L Recombinant Protein Antigen is derived from E. coli. The PGLYRP2/PGRP-L Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Tekniske data

Gen-id (Entrez) 114770
Oprensningsmetode >80% by SDS-PAGE and Coomassie blue staining
Fælles navn PGLYRP2/PGRP-L Recombinant Protein Antigen
Indhold og opbevaring Store at −20°C. Avoid freeze-thaw cycles
Formulering PBS and 1M Urea, pH 7.4
Til brug med (applikation) Blocking/Neutralizing, Control
Gene Alias EC 3.5.1.28, peptidoglycan recognition protein 2tagl-beta, peptidoglycan recognition protein L, PGLYRPLHMFT0141, PGRP-LN-acetylmuramoyl-L-alanine amidase, PGRPLPeptidoglycan recognition protein long, tagL, tagL-alpha, TAGL-like
Gen symbol PGLYRP2
Etikettype Unlabeled
Produkttype Recombinant Protein Antigen
Mængde 100 μl
Regulatorisk status RUO
Kilde E.coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53528. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Vis mere Vis mindre

For research use only.

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.