missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Novus Biologicals™ PER1 Recombinant Protein Antigen
Shop alle Bio Techne produkter
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Beskrivelse
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PER1. Source: E.coli Amino Acid Sequence: SILRYLESCNLPSTTKRKCASSSSYTTSSASDDDRQRTGPVSVGTKKDPPSAALSGEGATPRKEPVVGGTLSPLALANKAESVVSVTSQC The PER1 Recombinant Protein Antigen is derived from E. coli. The PER1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Tekniske data
Tekniske data
| Gen-id (Entrez) | 5187 |
| Oprensningsmetode | >80% by SDS-PAGE and Coomassie blue staining |
| Fælles navn | PER1 Recombinant Protein Antigen |
| Indhold og opbevaring | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulering | PBS and 1M Urea, pH 7.4. |
| Til brug med (applikation) | Blocking/Neutralizing, Control |
| Gene Alias | Circadian clock protein PERIOD 1, Circadian pacemaker protein Rigui, hPER1, KIAA0482, PERhPER, period (Drosophila) homolog 1, period circadian protein homolog 1, period homolog 1 (Drosophila), Period, drosophila, homolog of, RIGUIMGC88021 |
| Gen symbol | PER1 |
| Etikettype | Unlabeled |
| Produkttype | Recombinant Protein Antigen |
| Vis mere |
For Research Use Only.
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion