missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. PAC1R Antibody, R&D Systems™

PAC1R Antibody, R&D Systems™

Artikelnummer. 18604368 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μg
25 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18604368 100 μg
18699068 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18604368 Leverandør Novus Biologicals Leverandørnr. NBP268620
  • ONLINE EXCLUSIVE PRICE
    4677.79 DKK
    4042.50 DKK / 100µL
    Spare 635.29 DKK
    13% Slukket
 Begrænset vare
Forventet forsendelse: 02-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PAC1R Polyclonal antibody specifically detects PAC1R in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen PAC1R
Applikationer Immunofluorescence
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulering PBS (pH 7.2) and 40% Glycerol
Gene Alias adenylate cyclase activating polypeptide 1 (pituitary) receptor type 1, adenylate cyclase activating polypeptide 1 (pituitary) receptor type I, PACAP type I receptor, PACAP-R1, PACAP-R-1, PACAPRI, PACAPRPAC1, pituitary adenylate cyclase activating polypeptide 1 receptor type I Hiphop, pituitary adenylate cyclase-activating polypeptide type I receptor
Værtsarter Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRSFNPDQ
Oprensningsmetode Protein A purified
Mængde 100 μg
Regulatorisk status RUO
Forskningsdisciplin Cancer, Cell Cycle and Replication, GPCR, Neuroscience, Neurotransmission, Signal Transduction
Primær eller sekundær Primary
Gen-id (Entrez) 117
Målarter Human
Indhold og opbevaring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttype Antibody
Form Purified
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.