missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. p14ARF/CDKN2A Antibody, R&D Systems™

p14ARF/CDKN2A Antibody, R&D Systems™

Artikelnummer. 18621319 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18621319 25 μg
18635268 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18621319 Leverandør Novus Biologicals Leverandørnr. NBP30552125ul
 Begrænset vare
Forventet forsendelse: 01-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

p14ARF/CDKN2A Polyclonal specifically detects p14ARF/CDKN2A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen p14ARF/CDKN2A
Applikationer Immunocytochemistry/Immunofluorescence
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulering PBS, pH 7.2, containing 40% glycerol
Gene Alias ARF, CDK4 inhibitor p16-INK4, CDK4IP14ARF, CDKN2, cell cycle negative regulator beta, CMM2P16-INK4A, Cyclin-dependent kinase 4 inhibitor A, cyclin-dependent kinase inhibitor 2A, cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4), INK4, INK4A, MLMP16INK4, MTS-1, MTS1P14, Multiple tumor suppressor 1, p14, p14ARF, p16, p16-INK4, p16INK4a, p16-INK4a, P19, p19ARF, TP16
Værtsarter Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPS
Oprensningsmetode Affinity purified
Mængde 25 μg
Regulatorisk status RUO
Forskningsdisciplin ABC Transporters, Cancer, Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair, Hypoxia, MAP Kinase Signaling, Neuroscience, p53 Pathway, Transcription Factors and Regulators, Tumor Suppressors
Primær eller sekundær Primary
Gen-id (Entrez) 1029
Målarter Human
Indhold og opbevaring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttype Antibody
Form Purified
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.