missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
OTUD6A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3540.00 DKK
Tekniske data
| Antigen | OTUD6A |
|---|---|
| Applikationer | Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Værtsarter | Rabbit |
Beskrivelse
OTUD6A Polyclonal specifically detects OTUD6A in Human samples. It is validated for Western Blot.Tekniske data
| OTUD6A | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DUBA2, DUBA-2, OTU domain containing 6A | |
| OTUD6A | |
| IgG | |
| 32 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_997203 | |
| 139562 | |
| Synthetic peptide directed towards the N terminal of human OTUD6A. Peptide sequence MEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRER. | |
| Primary |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel