missing translation for 'onlineSavingsMsg'
Learn More

OR1J1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09388-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18310364

  • 3427.56 DKK / 100µL
Estimated Shipment: 25-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

OR1J1 Polyclonal specifically detects OR1J1 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

OR1J1
Polyclonal
Western Blot 1.0 ug/ml
hg32, olfactory receptor 1J1, Olfactory receptor OR9-18, olfactory receptor, family 1, subfamily J, member 1, OR9-18
The immunogen is a synthetic peptide directed towards the middle region of Mouse OR1J1 (NP_996786). Peptide sequence LGALLKLSCSDTSLNQLVIFTAGLAAIMLPFLCILISYGRIGFTILQVPT
100 μg
Primary
Mouse
Purified
Western Blot
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
347168
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers