missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR1J1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09388-100UL
Additional Details : Weight : 0.00970kg
Description
OR1J1 Polyclonal specifically detects OR1J1 in Mouse samples. It is validated for Western Blot.Specifications
| OR1J1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| hg32, olfactory receptor 1J1, Olfactory receptor OR9-18, olfactory receptor, family 1, subfamily J, member 1, OR9-18 | |
| The immunogen is a synthetic peptide directed towards the middle region of Mouse OR1J1 (NP_996786). Peptide sequence LGALLKLSCSDTSLNQLVIFTAGLAAIMLPFLCILISYGRIGFTILQVPT | |
| 100 μg | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 347168 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |