missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. Odf1 Antibody - Azide and BSA Free, R&D Systems™

Odf1 Antibody - Azide and BSA Free, R&D Systems™

Artikelnummer. 18606580 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.02 mL
0.1 mL
Pakningsstørrelse:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde Pakningsstørrelse
18606580 0.1 mL 0.1ml
18659650 0.02 mL -
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18606580 Leverandør Novus Biologicals Leverandørnr. NBP2936010.1ml
 Begrænset vare
Forventet forsendelse: 03-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Odf1 Polyclonal specifically detects Odf1 in Human, Mouse, Rat samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Odf1
Applikationer Western Blot
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Western Blot 1:500-1:2000
Formulering PBS (pH 7.3), 50% glycerol
Gene Alias cancer/testis antigen 133, CT133, HSPB10, MGC129928, MGC129929, ODF, ODF2, ODF27, ODFP, ODFPG, ODFPGA, ODFPGB, outer dense fiber of sperm tails 1, outer dense fiber of sperm tails, 27-kD, outer dense fiber protein 1, outer dense fibre of sperm tails 1, RT7, SODF
Værtsarter Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human ODF1 (NP_077721.2). LYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 4956
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at -20°C. Avoid freeze-thaw cycles.
Produkttype Antibody
Form Purified
Isotype IgG
Produktlinje Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.