missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Biokemiske reagenser
  4. Peptider
  5. 18232572

Novus Biologicals™ Nse2 Recombinant Protein Antigen

Artikelnummer. 18232572 Shop alle Bio Techne produkter
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 18232572

Brand: Novus Biologicals™ NBP258712PEP

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nse2. Source: E.coli Amino Acid Sequence: SQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKK The Nse2 Recombinant Protein Antigen is derived from E. coli. The Nse2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Tekniske data

Gen-id (Entrez) 286053
Oprensningsmetode >80% by SDS-PAGE and Coomassie blue staining
Fælles navn Nse2 Recombinant Protein Antigen
Indhold og opbevaring Store at −20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
Til brug med (applikation) Blocking/Neutralizing, Control
Gene Alias C8orf36, E3 SUMO-protein ligase NSE2, EC 6.3.2, EC 6.3.2.-, FLJ32440, hMMS21, methyl methanesulfonate sensitivity gene 21, MMS21 homolog, MMS21chromosome 8 open reading frame 36, Non-SMC element 2 homolog, non-SMC element 2 homolog (MMS21, S. cerevisiae),
Gen symbol NSMCE2
Etikettype Unlabeled
Produkttype Recombinant Protein Antigen
Mængde 100 μL
Regulatorisk status RUO
Kilde E.coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50205. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Vis mere Vis mindre

For Research Use Only.

Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.