missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498963

NEK7 Antibody [DyLight 755], Novus Biologicals Biologicals™

Artikelnummer. 30498963 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
30498963 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498963 Leverandør Novus Biologicals Leverandørnr. NBP337907IR

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

NEK7 Polyclonal antibody specifically detects NEK7 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen NEK7
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret DyLight 755
Formulering 50mM Sodium Borate
Gene Alias EC 2.7.11.1, Never in mitosis A-related kinase 7, NIMA (never in mitosis gene a)-related kinase 7, NimA-related protein kinase 7, serine/threonine-protein kinase Nek7
Værtsarter Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 257-301 of human NEK7 (NP_598001.1).,, Sequence:, PLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTAS
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Protein Kinase
Primær eller sekundær Primary
Gen-id (Entrez) 140609
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.