missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Biokemiske reagenser
  4. Peptider
  5. 18235234

Novus Biologicals™ NCKAP5 Recombinant Protein Antigen

Artikelnummer. 18235234 Shop alle Bio Techne produkter
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 18235234

Brand: Novus Biologicals™ NBP255168PEP

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCKAP5. Source: E.coli Amino Acid Sequence: PELQCETENELIKDTKSADNPDGGLQSKNNRRTPQDIYNQLKIEPRNRHSPVACSTKDTFMTELLNRVDKKAAPQTESGSSNASCRNVLKGSSQ The NCKAP5 Recombinant Protein Antigen is derived from E. coli. The NCKAP5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Tekniske data

Gen-id (Entrez) 344148
Oprensningsmetode >80% by SDS-PAGE and Coomassie blue staining
Fælles navn NCKAP5 Recombinant Protein Antigen
Indhold og opbevaring Store at −20°C. Avoid freeze-thaw cycles
Formulering PBS and 1M Urea, pH 7.4
Til brug med (applikation) Blocking/Neutralizing, Control
Gene Alias ERIH, ERIH1, ERIH2, FLJ34870, NAP5, NAP-5, Nck associated protein 5, NCK-associated protein 5, peripheral clock protein 2
Gen symbol NCKAP5
Etikettype Unlabeled
Produkttype Recombinant Protein Antigen
Mængde 100 μL
Regulatorisk status RUO
Kilde E.coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51456. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Vis mere Vis mindre

For research use only.

Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato