Få mere at vide
Abnova™ NAPSA Recombinant Protein
Beskrivelse
The activation peptides of aspartic proteinases plays role as inhibitors of the active site. These peptide segments, or pro-parts, are deemed important for correct folding, targeting, and control of the activation of aspartic proteinase zymogens. The pronapsin A gene is expressed predominantly in lung and kidney. Its translation product is predicted to be a fully functional, glycosylated aspartic proteinase precursor containing an RGD motif and an additional 18 residues at its C-terminus
- Theoretical MW (kDa): 69.19
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in elution buffer
Sequence: LIRIPLHRVQPGRRTLNLLRGWREPAELPKLGAPSPGDKPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Tekniske data
Tekniske data
| Adgangsnummer | AAH17842 |
| Til brug med (applikation) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulering | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Gen-id (Entrez) | 9476 |
| Molekylvægt (g/mol) | 69.19 |
| Navn | NAPSA (Human) Recombinant Protein (P01) |
| pH-område | 8 |
| Fremstillingsmetode | In vitro wheat germ expression system |
| Oprensningsmetode | Glutathione Sepharose 4 Fast Flow |
| Kvalitetskontrol test | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Vis mere |
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.