missing translation for 'onlineSavingsMsg'
Få mere at vide

Abnova™ NAPSA Recombinant Protein

Artikelnummer. 16133722
Klik for at se tilgængelige muligheder
Mængde:
10 μg
25 μg
Pakningsstørrelse:
10µg
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 16133722

Brand: Abnova™ H00009476P01.10ug

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Human NAPSA full-length ORF recombinant protein with GST-tag at N-terminal

The activation peptides of aspartic proteinases plays role as inhibitors of the active site. These peptide segments, or pro-parts, are deemed important for correct folding, targeting, and control of the activation of aspartic proteinase zymogens. The pronapsin A gene is expressed predominantly in lung and kidney. Its translation product is predicted to be a fully functional, glycosylated aspartic proteinase precursor containing an RGD motif and an additional 18 residues at its C-terminus

  • Theoretical MW (kDa): 69.19
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in elution buffer

Sequence: LIRIPLHRVQPGRRTLNLLRGWREPAELPKLGAPSPGDKPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG

Best when used within three months from the date of receipt.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Tekniske data

Adgangsnummer AAH17842
Til brug med (applikation) Antibody Production, Protein Array, ELISA, Western Blot
Formulering 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gen-id (Entrez) 9476
Molekylvægt (g/mol) 69.19
Navn NAPSA (Human) Recombinant Protein (P01)
pH-område 8
Fremstillingsmetode In vitro wheat germ expression system
Oprensningsmetode Glutathione Sepharose 4 Fast Flow
Kvalitetskontrol test 12.5% SDS-PAGE Stained with Coomassie Blue.
Mængde 10 μg
Kilde Wheat Germ (in vitro)
Immunogen LIRIPLHRVQPGRRTLNLLRGWREPAELPKLGAPSPGDKPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
Opbevaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias KAP/Kdap/NAP1/NAPA/SNAPA
Fælles navn NAPSA
Gen symbol NAPSA
Krydsreaktivitet Human
Arter Wheat Germ (in vitro)
Rekombinant Recombinant
Protein tag GST
Form Solution
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.