missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
NAPB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3540.00 DKK
Tekniske data
| Antigen | NAPB |
|---|---|
| Applikationer | Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Værtsarter | Rabbit |
Beskrivelse
NAPB Polyclonal specifically detects NAPB in Human samples. It is validated for Western Blot.Tekniske data
| NAPB | |
| Polyclonal | |
| Rabbit | |
| NP_071363 | |
| 63908 | |
| Synthetic peptide directed towards the N terminal of human NAPB. Peptide sequence MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAAN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MGC26066, N-ethylmaleimide-sensitive factor attachment protein, beta, SNAP-BETA | |
| NAPB | |
| IgG | |
| 33 kDa |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel