missing translation for 'onlineSavingsMsg'
Få mere at vide

Myotubularin Antibody [DyLight 350], Novus Biologicals Biologicals™

Artikelnummer. 30498486 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30498486 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498486 Leverandør Novus Biologicals Leverandørnr. NBP335068UV

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Rabbit Polyclonal Antibody

Myotubularin Polyclonal antibody specifically detects Myotubularin in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen Myotubularin
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret DyLight 350
Formulering 50mM Sodium Borate
Gene Alias CG2, CNM, EC 3.1.3.48, MTMX, myotubular myopathy 1, myotubularin, myotubularin 1, XLMTM
Værtsarter Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 484-603 of human Myotubularin (NP_000243.1).,, Sequence:, SARERQKVTERTVSLWSLINSNKEKFKNPFYTKEINRVLYPVASMRHLELWVNYYIRWNPRIKQQQPNPVEQRYMELLALRDEYIKRLEELQLANSAKLSDPPTSPSSPSQMMPHVQTHF
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Protein Phosphatase
Primær eller sekundær Primary
Gen-id (Entrez) 4534
Målarter Human, Mouse
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.