missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. MSH2 Antibody, R&D Systems™

MSH2 Antibody, R&D Systems™

Artikelnummer. 18610379 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μg
25 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18610379 100 μg
18607298 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18610379 Leverandør Novus Biologicals Leverandørnr. NBP268845
 Begrænset vare
Forventet forsendelse: 01-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

MSH2 Polyclonal antibody specifically detects MSH2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen MSH2
Applikationer Immunofluorescence
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulering PBS (pH 7.2) and 40% Glycerol
Gene Alias COCA1, DNA mismatch repair protein Msh2, FCC1, hMSH2, HNPCC, HNPCC1mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1), LCFS2, mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli), MutS protein homolog 2
Værtsarter Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLA
Oprensningsmetode Protein A purified
Mængde 100 μg
Regulatorisk status RUO
Forskningsdisciplin Breast Cancer, Cancer, Core ESC Like Genes, DNA Repair, Mismatch Repair, Stem Cell Markers, Tumor Suppressors
Primær eller sekundær Primary
Gen-id (Entrez) 4436
Målarter Human
Indhold og opbevaring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttype Antibody
Form Purified
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.