missing translation for 'onlineSavingsMsg'
Få mere at vide

Abnova™ MRPL23 Recombinant Protein

Artikelnummer. 16180292
Klik for at se tilgængelige muligheder
Mængde:
10 μg
25 μg
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 16180292

Brand: Abnova™ H00006150P01.10ug

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

This item is not returnable. View return policy

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Adgangsnummer AAH27710
Til brug med (applikation) Antibody Production, Protein Array, ELISA, Western Blot
Formulering 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gen-id (Entrez) 6150
Molekylvægt (g/mol) 42.68
Navn MRPL23 (Human) Recombinant Protein (P01)
pH-område 8
Fremstillingsmetode In vitro wheat germ expression system
Oprensningsmetode Glutathione Sepharose 4 Fast Flow
Kvalitetskontrol test 12.5% SDS-PAGE Stained with Coomassie Blue.
Mængde 10 μg
Kilde Wheat Germ (in vitro)
Immunogen MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL
Opbevaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias FLJ45387/L23MRP/RPL23/RPL23L
Fælles navn MRPL23
Gen symbol MRPL23
Krydsreaktivitet Human
Arter Wheat Germ (in vitro)
Rekombinant Recombinant
Protein tag GST
Form Solution
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.