missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
MICAL3 Antibody (3A6), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00057553-M08
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
MICAL3 Monoclonal antibody specifically detects MICAL3 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA
Tekniske data
| MICAL3 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| microtubule associated monoxygenase, calponin and LIM domain containing 3 | |
| MICAL3 (XP_032996.2, 251 a.a. ∽ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DDQHWSDSPSDADRELRLPCPAEGEAELELRVSEDEEKLPASPKHQERGPSQATSPIRSPQESALLFIPVHSPSTEGPQLPPVPAATQEK | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Sandwich ELISA | |
| 3A6 | |
| Western Blot, ELISA, Sandwich ELISA | |
| XP_032996.2 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 57553 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion