missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. Abnova™ MGC50811 Recombinant Protein

Abnova™ MGC50811 Recombinant Protein

Artikelnummer. 16140394
missing translation for 'orderingAttributeHoverText'
Mængde:
10 μg
25 μg
This item is not returnable. View return policy

Product Code. 16140394

missing translation for 'mfr': Abnova™ H00375307P01.10ug

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

This item is not returnable. View return policy

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Adgangsnummer AAH52750
Til brug med (applikation) Antibody Production, Protein Array, ELISA, Western Blot
Formulering 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gen-id (Entrez) 375307
Molekylvægt (g/mol) 68.31
Navn MGC50811 (Human) Recombinant Protein (P01)
pH-område 8
Fremstillingsmetode In vitro wheat germ expression system
Oprensningsmetode Glutathione Sepharose 4 Fast Flow
Kvalitetskontrol test 12.5% SDS-PAGE Stained with Coomassie Blue.
Mængde 10 μg
Kilde Wheat Germ (in vitro)
Immunogen MSSKVYSTGSRAKDHQPSGPECLPLPEANAEAIDFLSSLHKEELQMLFFSETLAMVSDTGEPQGELTIEVQRGKYQEKLGMLTYCLFVHASSRGFLDKMLCGNSLLGYLSEKLELMEQHSQDFIKFLILPMERKMSLLKQDDQLAVTRSIKEGEEVKTGVTSFPWSSIKGFISEAANLVLLRVMAWRRMVPSNARFLTLDTEGKLCYLTYQNLGFQTIQVDHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLDRKEELRLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFFGPFDPWRPSSPALGSSHRPNPFRSLEPEGDARSGAA
Opbevaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias MGC50811
Fælles navn C2orf62
Gen symbol C2orf62
Krydsreaktivitet Human
Arter Wheat Germ (in vitro)
Rekombinant Recombinant
Protein tag GST
Form Solution
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.