missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 16354605

Invitrogen™ MGA Polyclonal Antibody
GREENER_CHOICE

Artikelnummer. 16354605 Shop alle Thermo Scientific produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
16354605 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 16354605 Leverandør Invitrogen™ Leverandørnr. PA595338

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, MCF-7 whole cell, SW620 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Functions as a dual-specificity transcription factor, regulating the expression of both MAX-network and T-box family target genes. Functions as a repressor or an activator. Binds to 5'-AATTTCACACCTAGGTGTGAAATT-3' core sequence and seems to regulate MYC-MAX target genes. Suppresses transcriptional activation by MYC and inhibits MYC-dependent cell transformation. Function activated by heterodimerization with MAX. This heterodimerization serves the dual function of both generating an E-box-binding heterodimer and simultaneously blocking interaction of a corepressor. [UniProt].
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen MGA
Applikationer Western Blot
Klassifikation Polyclonal
Koncentration 500 μg/mL
Konjugeret Unconjugated
Formulering PBS with 4mg trehalose and 0.05mg sodium azide
Gene MGA
Genadgangsnr. Q8IWI9
Gene Alias AV312082; C130042M01Rik; C80739; D030062C11Rik; FLJ12634; KIAA0518; Kiaa4252; LOW QUALITY PROTEIN: MAX gene-associated protein; Mad5; maltase-glucoamylase (alpha-glucosidase); Max dimerization protein 5; MAX dimerization protein MGA; MAX gene associated; MAX gene-associated protein; MAX protein-associated protein-like protein; MAX-associated protein; MAX-interacting protein; MGA; MGA, MAX dimerization protein; MGA-like protein; MXD5; RGD1561597
Gensymboler MGA
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human MGA (2376-2415aa QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH).
Oprensningsmetode Affinity chromatography
Mængde 100 μg
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 23269
Målarter Human
Indhold og opbevaring -20°C
Produkttype Antibody
Form Lyophilized
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.