missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. MED28 Antibody, R&D Systems™

MED28 Antibody, R&D Systems™

Artikelnummer. 18614466 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18614466 25 μL
18127348 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18614466 Leverandør Novus Biologicals Leverandørnr. NBP23827125ul
 Begrænset vare
Forventet forsendelse: 01-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

MED28 Polyclonal specifically detects MED28 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen MED28
Applikationer Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Genadgangsnr. Q9H204
Gene Alias DKFZP434N185, EG1DKFZp434N185, magicin, mediator complex subunit 281500003D12Rik, mediator of RNA polymerase II transcription, subunit 28 homolog (S. cerevisiae), subunit 28 homolog
Gensymboler MED28
Værtsarter Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQV
Oprensningsmetode Affinity Purified
Mængde 25 μL
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 80306
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Indhold og opbevaring Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Produkttype Antibody
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.