missing translation for 'onlineSavingsMsg'
Learn More

MED17 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17737-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18310505

  • 4398.37 DKK / 100µL
Estimated Shipment: 28-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

MED17 Polyclonal antibody specifically detects MED17 in Human samples. It is validated for Immunofluorescence
Specifications

Specifications

MED17
Polyclonal
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Activator-recruited cofactor 77 kDa component, Cofactor required for Sp1 transcriptional activation subunit 6, cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa, CRSP6FLJ10812, CRSP77cofactor required for Sp1 transcriptional activation, subunit 6 (77kD), DRIP77, DRIP80ARC77, mediator complex subunit 17Vitamin D3 receptor-interacting protein complex 80 kDa component, mediator of RNA polymerase II transcription subunit 17, Thyroid hormone receptor-associated protein complex 80 kDa component, Transcriptional coactivator CRSP77, Trap80, TRAP80CRSP complex subunit 6
This antibody was developed against Recombinant Protein corresponding to amino acids: IGVEQIRVVHRDGRVITLSYQEQELQDFLLSQMSQHQVHAVQQLAKVMGWQVLSFSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRN
100 μg
Signal Transduction
9440
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
IgG
Immunofluorescence
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers