missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
MDH1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
2100.00 DKK - 4035.00 DKK
Tekniske data
| Antigen | MDH1 |
|---|---|
| Fortynding | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applikationer | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Produktkode | Brand | Mængde | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Mængde | Pris | Antal & tilgængelighed | |||||
|
18405681
|
Novus Biologicals
NBP1-89515-25ul |
25 μL |
2100.00 DKK
25µL |
Venligst log indfor at købe denne vare. Brug for en webkonto? Register dig hos os i dag! | |||||
|
18739553
|
Novus Biologicals
NBP1-89515 |
0.1 mL |
4035.00 DKK
0.10ml |
Venligst log indfor at købe denne vare. Brug for en webkonto? Register dig hos os i dag! | |||||
Beskrivelse
MDH1 Polyclonal specifically detects MDH1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Tekniske data
| MDH1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 4190 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| cytoplasmic, Cytosolic malate dehydrogenase, malate dehydrogenase 1, NAD (soluble), MDHA, MDH-s, MGC:1375, MOR2, soluble malate dehydrogenase | |
| MDH1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human MDH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel