missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
LRDD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
4670.00 DKK
Tekniske data
| Antigen | LRDD |
|---|---|
| Applikationer | Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Værtsarter | Rabbit |
Beskrivelse
LRDD Polyclonal specifically detects LRDD in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Tekniske data
| LRDD | |
| Polyclonal | |
| Rabbit | |
| Human | |
| leucine-rich repeat and death domain-containing protein, leucine-rich repeats and death domain containing, MGC16925, p53-induced protein with a death domain, PIDDDKFZp434D229 | |
| PIDD1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 55367 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SFPVTPRGCSVTLACGVRLQFPAGATATPITIRYRLLLPEPGLVPLGPHDALLSHVLELQPHGVAFQQDVGLWLLFTPPQARRCREVVV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel