missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ KV1.2 (KCNA2) Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA5144086

Produktkode 17921361

  • 3090.00 DKK / 100µg

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolitik

Beskrivelse

Beskrivelse

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is identical to the related mouse and rat sequences. Positive Control - WB: Rat Kidney Tissue, Rat Brain Tissue, Mouse Brain Tissue, Mouse Kidney Tissue. ICC/IF: U20S cell. Flow: A431 cell, C6 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Kcna2 is a voltage-gated potassium channel (KV) that belongs to the 6-TM family of potassium channel and also comprises the Ca2+-activated Slo (actually 7-TM) and the Ca2+-activated SK subfamilies. The alpha-subunits contain a single pore-forming region and combine to form tetramers. Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. The diverse functions of potassium channels include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). The Kcna2 gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. Kcna2 contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. Further, Kcna2 belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of the Kcna2 gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1. Diseases associated with KCNA2 include Epileptic Encephalopathy (Early Infantile, 32) and Undetermined Early-Onset Epileptic Encephalopathy.
TRUSTED_SUSTAINABILITY
Tekniske data

Tekniske data

KV1.2 (KCNA2)
Polyclonal
Unconjugated
KCNA2
Akr6a4; BK2; CSMK1; delayed rectifier K+ channel; EIEE32; ENSMUSG00000074335; Gm10672; HBK5; HK4; HUKIV; k(v)1.2; KC22; Kca1-2; kcna2; kcna2.S; kcna2-a; KV1.2; Kv1.2' potassium channel; LOC100537815; MK2; Mk-2; NGK1; Potassium (K+) channel protein alpha 2, voltage dependent; potassium channel (BGK5); potassium channel subunit Kv 1.2; potassium channel, voltage gated shaker related subfamily A, member 2; potassium channel, voltage gated shaker related subfamily A, member 2 S homeolog; potassium voltage gated channel shaker related subfamily member 2; potassium voltage-gated channel subfamily A member 2; potassium voltage-gated channel, shaker-related subfamily, member 2; potassium voltage-gated channel, shaker-related subfamily, member 2 a; RAK; RBK2; RCK5; RP11-284N8.1; voltage-dependent K channel; voltage-gated channel, shaker-related subfamily, member 2; voltage-gated K(+) channel HuKIV; Voltage-gated potassium channel HBK5; voltage-gated potassium channel isoform 2; voltage-gated potassium channel isoform 3; voltage-gated potassium channel protein Kv1.2; Voltage-gated potassium channel subunit Kv1.2; XELAEV_18011981mg; XSha2
Rabbit
Antigen affinity chromatography
RUO
16490, 25468, 3737
-20°C
Lyophilized
Flow Cytometry, Western Blot, Immunocytochemistry
500 μg/mL
PBS with 5mg BSA and 0.05mg sodium azide
P16389, P63141, P63142
KCNA2
A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.2 (466-499aa NNSNEDFREENLKTANCTLANTNYVNITKMLTDV).
100 μg
Primary
Human, Mouse, Rat
Antibody
IgG
Produktforslag

Produktforslag

Videoer
SDS
Dokumenter

Dokumenter

Certifikater
Kampagner

Kampagner

Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.