missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
KERA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
4275.00 DKK
Tekniske data
| Antigen | KERA |
|---|---|
| Fortynding | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applikationer | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
Beskrivelse
KERA Polyclonal specifically detects KERA in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Tekniske data
| KERA | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 11081 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SRSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIPSRIWYLYL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| CNA2, keratocan, KTN, SLRR2BKeratan sulfate proteoglycan keratocan | |
| KERA | |
| IgG | |
| Affinity Purified | |
| Specificity of human KERA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel