missing translation for 'onlineSavingsMsg'
Learn More

ITIH5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09495-100UL

Additional Details : Weight : 0.00970kg

Product Code. 18310564

Estimated Shipment: 26-08-2024
to see stock.

Description

ITIH5 Polyclonal specifically detects ITIH5 in Human samples. It is validated for Western Blot.

Specifications

Antigen	ITIH5
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	inter-alpha (globulin) inhibitor H5, inter-alpha-inhibitor heavy chain 5, inter-alpha-trypsin inhibitor heavy chain H5, ITI heavy chain H5, ITIH5 inter-alpha-trypsin inhibitor heavy chain family, member 5, ITI-HC5, PP14776
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Human ITIH5 (NP_085046). Peptide sequence AAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIF
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	80760
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description