missing translation for 'onlineSavingsMsg'
Learn More

ITIH5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09495-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18310564

  • 3439.44 DKK / 100µL
Estimated Shipment: 25-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ITIH5 Polyclonal specifically detects ITIH5 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ITIH5
Polyclonal
Western Blot 1.0 ug/ml
inter-alpha (globulin) inhibitor H5, inter-alpha-inhibitor heavy chain 5, inter-alpha-trypsin inhibitor heavy chain H5, ITI heavy chain H5, ITIH5 inter-alpha-trypsin inhibitor heavy chain family, member 5, ITI-HC5, PP14776
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ITIH5 (NP_085046). Peptide sequence AAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIF
100 μg
Primary
Human
Purified
Western Blot
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
80760
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers