missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. IGF2BP1 Antibody, R&D Systems™

IGF2BP1 Antibody, R&D Systems™

Artikelnummer. 18620656 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
25 μL
0.1 mL
Pakningsstørrelse:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde Pakningsstørrelse
18620656 25 μL -
18095186 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18620656 Leverandør Novus Biologicals Leverandørnr. NBP23895625ul
 Begrænset vare
Forventet forsendelse: 02-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

IGF2BP1 Polyclonal specifically detects IGF2BP1 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen IGF2BP1
Applikationer Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Western Blot 0.04 - 0.4 μg/mL, Simple Western 1:10, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Genadgangsnr. Q9NZI8
Gene Alias Coding region determinant-binding protein, CRD-BP, CRDBPIGF-II mRNA-binding protein 1, IGF II mRNA binding protein 1, IMP1, IMP-1ZBP-1, insulin-like growth factor 2 mRNA binding protein 1, insulin-like growth factor 2 mRNA-binding protein 1, VICKZ family member 1, VICKZ1, ZBP1IGF2 mRNA-binding protein 1, Zip code-binding protein 1, Zipcode-binding protein 1
Gensymboler IGF2BP1
Værtsarter Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI
Oprensningsmetode Affinity Purified
Mængde 25 μL
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 10642
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Indhold og opbevaring Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Produkttype Antibody
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.