missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ IDI1 (Human) Recombinant Protein

Human IDI1 full-length ORF ( AAH05247.1, 1 a.a. - 228 a.a.) recombinant protein with GST-tag at N-terminal.

2665.00 DKK - 4040.00 DKK

Accession Number	AAH05247.1
Gene ID (Entrez)	3422
Name	isopentenyl-diphosphate delta isomerase 1
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16129804 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00003422-P01.10UG	10 μg	2665.00 DKK 10µg View alternative products Save Up to »	Estimated Shipment: 11-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

16139804 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00003422-P01.25UG	25 μg	4040.00 DKK 25µg View alternative products Save Up to »	Estimated Shipment: 11-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM

Specifications

Accession Number	AAH05247.1
Name	isopentenyl-diphosphate delta isomerase 1
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Alias	IPP1, IPPI1
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	3422
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	IDI1
Protein Tag	GST

Description